Overview

I've added my Vendor ID to the appropriate entitlement files but my binary fails validation when trying to upload it to the store for distribution. The embeded.mobileprovision file in the generated archive shows an asterisk instead of my approved Vendor ID. How can I make sure the embedded provisioning file has my Vendor ID?

I am developing an WKWebView app that runs on both mobile and mac platforms using a react website. Currently, an admin user can send a call request in which the user gets a pop-up to answer. on iOS it works as intended, the user is asked to grant permission to utilize camera and microphone and the user is immediately connected upon accepting, however I never receive the pop-up when running in Mac Catalyst. I have ensured to enable permissions in sandbox settings as well as adding NSCamera and NSMic permissions in the property list. in the safari debugging console I receive this error upon clicking the accept call ReferenceError: Can't find variable: RTCPeerConnection Ive attempted to use the webview callback requestMediaCapturePermissionFor, and this did not seem to trigger on attempting to answer the call. Is this an error on my development end? or is this an issue I should look to the react code for a fix. I appreciate any feedback possible. Thanks.

I am managing a subscribed calendar through my iPhone and am curious about how iOS handles 4xx error responses from calendar APIs. Specifically, I would like to know if there is a process that stops the iPhone from attempting to sync the calendar if it consistently receives 4xx errors from the server. Does iOS have a mechanism to pause or stop calendar sync under such error conditions to prevent unnecessary data usage and battery drain? Any guidance or insights on this behavior would be greatly appreciated.

I have an online service where it lets people subscribe to iCalendar feed. I'm wondering if there is a way to force the subscriber (their Calendar client) to stop their subscription. I have some subscribers who subscribed to a feed that doesn't exist anymore. The annoying part is that these subscribers is fetching the data every 30 seconds! I looked at iCalendar specification and it doesn't look like this is supported. I tried few http response codes (404 and 410), but this doesn't stop the client. The user agent I'm seeing in the log shows "iOS/17.4 (21E219) dataaccessd/1.0". Any help is appreciated.

how we can implement music kit in flutter app?

SwiftData includes support for CloudKit sync. However, I don't see any way to add conflict resolution behavior. For example, if different devices set different values for a field, or if a relationship is orphaned because of a deletion on another device, the application has to handle this somehow. In Core Data (which SwiftData wraps), you can handle this with the conflict resolution system (docs) and classes like NSMergePolicy. Is any of this accessible in SwiftData? If not, how do you deal with conflicts when syncing a SwiftData model with the cloud?

Recently, I have made quite extensive changes to my schema and need to migrate my CoreData + CloudKit model to a new version. The changes require me to use a custom NSEntityMigrationPolicy because I have a rather complex mapping between some old entities and new entities. I have added a new model version. Deleted some entities, and added some entities. I have defined the NSEntityMigrationPolicy with createDestinationInstances(forSource:in:manager:) and createRelationships(forDestination:in:manager:). I have created a new Core Data Mapping Model. This was probably unnecessary. Within the Core Data Mapping Model, I have specified Custom Policy for all entities. In my container setup, I added two options, as below: storeDescription.setOption(false as NSNumber, forKey: NSMigratePersistentStoresAutomaticallyOption) storeDescription.setOption(false as NSNumber, forKey: NSInferMappingModelAutomaticallyOption) I mostly followed a "Core Data Heavyweight Migration" guide. I'm unable to share the link, but it can be quite easily found on the web. (It's not for CloudKit specifically.) When I run my app, I am getting the most basic of errors, which is: The managed object model version used to open the persistent store is incompatible with the one that was used to create the persistent store. So I guess that migration wasn't even attempted, which makes sense because I set NSMigratePersistentStoresAutomaticallyOption to false. I tried to go beyond what I could find on the web and attempted to manually initialize migration: let sourceModel = container.persistentStoreCoordinator.managedObjectModel guard let modelURL = Bundle.main.url(forResource: "MyModelName", withExtension: "xcdatamodeld") else { fatalError("Unable to locate model file.") } guard let destinationModel = NSManagedObjectModel(contentsOf: modelURL) else { fatalError("Unable to load destination model.") } let migrationManager = NSMigrationManager(sourceModel: sourceModel, destinationModel: destinationModel) let mappingModel = NSMappingModel(from: [Bundle.main], forSourceModel: sourceModel, destinationModel: destinationModel)! migrationManager.currentEntityMapping.entityMigrationPolicyClassName = "MyMigrationPolicyClassName" I am then stuck at the migrateStore(from:type:mapping:to:type:) method. It seems to target only local storage, not CloudKit. Otherwise, what do I provide for URLs and types? Any guidance for custom logic CoreData with CloudKit migration would be greatly appreciated.

I ran it (Leaks) on a process for about 2 hours. It collected 68gytes of data. It cannot open the folder -- can't find a file (which is there as a .zip archive) or if I expand it, just an error about missing an index. Filing a bug about this is difficult, since it's 68gbyets of data.

Hello, we have a pkg file which used to be easily notarized using a particular apple id, but after we shifted to another account it is taking like forever. We have created an app-specific-password and made use of it. Anything that we have done incorrectly? Current status: In Progress........................................................[12:12:27.335Z] Info [API] Waiting 20 seconds before next poll... [12:12:47.337Z] Info [API] Preparing GET request to URL: https://appstoreconnect.apple.com/notary/v2/submissions/***-xxxxxx?, Parameters: [:], Custom Headers: private<Dictionary<String, String>> [12:12:47.338Z] Debug [AUTHENTICATION] Using cached token value for app-specific password request: xxxxx:xxxxx@*** [12:12:47.338Z] Debug [AUTHENTICATION] Authenticating request to '/notary/v2/submissions/***-xxxxxx' with WebServices Token. AppleID: xxxx@***, Team ID: xxxxxxxxxx, Token: private<String> [12:12:47.339Z] Debug [TASKMANAGER] Starting Task Manager loop to wait for asynchronous HTTP calls. [12:12:47.886Z] Debug [API] Received response status code: 200, message: no error, URL: https://appstoreconnect.apple.com/notary/v2/submissions/***-xxxxxx?, Correlation Key: GBCZEFTI5NQ3263GKRANCEPD4I [12:12:47.887Z] Debug [TASKMANAGER] Completed Task with ID 58 has received a parsable response. [12:12:47.887Z] Debug [TASKMANAGER] Ending Task Manager loop. [12:12:47.888Z] Info [API] Received new status: In Progress

Hey there, I'm trying to decode an json with an dynamic dict as value. eg. "results": [ { "id": 1799, "created_at": "2024-05-09T14:21:13.289655Z", "updated_at": "2024-05-10T11:54:25.484537Z", "email": "test@test.testh", "name": "Test", "attributes": { "name": { "firstname": "max", "lastname": "mustermann" }, "anboolen": false, "anNumber": 1, "anString": "Test" } } ] The dictionary "attributes" is always an dictionary but the content inside could be everything. for the container of results I already created an struct and using JSONDecoder to decode, but now I have the issue with the attributes part. Can anyone help me with this issue? Thanks in advance!

Our app needs to scan QR codes (or a similar mechanism) to populate it with content the user wants to see. Is there any update on QR code scanning availability on this platform? I asked this before, but never got any feedback. I know that there is no way to access the camera (which is an issue in itself), but at least the system could provide an API to scan codes. (It would be also cool if we were able to use the same codes Vision Pro uses for detecting the Zeiss glasses, as long as we could create these via server-side JavaScript code.)

I created Keyboard extension and calling an api in it. Api is successfully called when i run the extension on iOS Simulator’s. But when i run the extension on iOS device Extension in loaded successfully but Api call is getting failed with error mentioned below. 2024-05-10 16:23:44.931827+0500 CustomKeyboardExtention[4073:48324] dnssd_clientstub ConnectToServer: connect() failed path:/var/run/mDNSResponder Socket:11 Err:-1 Errno:1 Operation not permitted 2024-05-10 16:23:44.932654+0500 CustomKeyboardExtention[4073:48324] [connection] nw_resolver_create_dns_service_locked [C1] DNSServiceCreateDelegateConnection failed: ServiceNotRunning(-65563) 2024-05-10 16:23:44.935914+0500 CustomKeyboardExtention[4073:48324] Connection 1: received failure notification 2024-05-10 16:23:44.936849+0500 CustomKeyboardExtention[4073:48324] Connection 1: failed to connect 10:-72000, reason -1 2024-05-10 16:23:44.937747+0500 CustomKeyboardExtention[4073:48324] Connection 1: encountered error(10:-72000) 2024-05-10 16:23:44.942682+0500 CustomKeyboardExtention[4073:48324] Task .<1> HTTP load failed, 0/0 bytes (error code: -1003 [10:-72000]) 2024-05-10 16:23:44.949787+0500 CustomKeyboardExtention[4073:48324] Task .<1> finished with error [-1003] Error Domain=NSURLErrorDomain Code=-1003 "A server with the specified hostname could not be found." UserInfo={_kCFStreamErrorCodeKey=-72000, NSUnderlyingError=0x283aa35a0 {Error Domain=kCFErrorDomainCFNetwork Code=-1003 "(null)" UserInfo={_NSURLErrorNWPathKey=satisfied (Path is satisfied), interface: en0, ipv4, dns, _kCFStreamErrorCodeKey=-72000, _kCFStreamErrorDomainKey=10}}, _NSURLErrorFailingURLSessionTaskErrorKey=LocalDataTask .<1>, _NSURLErrorRelatedURLSessionTaskErrorKey=( "LocalDataTask .<1>" ), NSLocalizedDescription=A server with the specified hostname could not be found., NSErrorFailingURLStringKey=https://chatbotsf-vzt2zxsi7q-uc.a.run.app/chatbot/, NSErrorFailingURLKey=https://chatbotsf-vzt2zxsi7q-uc.a.run.app/chatbot/, _kCFStreamErrorDomainKey=10} Error fetching data: URLSessionTask failed with error: A server with the specified hostname could not be found.

Hi, I'm looking at being able to set a display colour profile via terminal. I know apps such as SwitchResX are able to change this but i can't figure out how and if it is possible to switch via a terminal command or via a script. This here is what i would like to change. I have googled about and searched through preference files but can't find anything. Any help is much apreciated. Thanks, James

By Implementing the TipKit framework in the AppKit Mac OS application, we were unable to close the popover when we clicked on the cross icon presented in TipNSPopover view. And any clues about how to implement the TipNSPopover on Handover of NScollectionview ?. When the mouse enters any of the collection view cells, I have to present the TipNSpopover view. Please share your input and thoughts.

Xcode 15 introduced official support for static frameworks. docs here This is presumably because there's quite a bit over overlap with the mergeable libraries feature. Static frameworks potentially give developers a nice option for bundling resources with a static library. This was previously only really viable if you explicitly packaged up a .bundle with your .a (static library) which could be cumbersome for both the creator and consumer of a library. Or you explicitly copied your framework resources into your main app binary when building your app. The release notes for Xcode 15 state: Embedding a static framework using a Copy Files build phase now removes the static archive from the framework when it is embedded in the target bundle. When inspecting the app target on disk this appears to be the case. In fact the behaviour is the same as with a mergable in release mode whereby a "stub" binary exists with no symbols. The release notes also state: The COPY_RESOURCES_FROM_STATIC_FRAMEWORKS build setting, previously used in the legacy build system to extract and copy the resources from a static framework to the target bundle, no longer has any effect with the new build system as the entire framework is copied instead This also appears to be the case when inspecting the files on disk as the frameworks appear to be present in the main app with their resources. So far so good. The issue arises when trying to access the bundle associated with this framework. The documentation doesn't mention any special access requirements to it's assumed that standard bundle access APIs should work. Using a class let bundle = Bundle(for: InfoCoreMain.self) This returns the main application bundle and therefore fails to find the correct asset. This can be rationalised by the fact that the InfoCoreMain class does now actually exist within the main app target binary due to being statically linked. It's worth noting however, that mergable libraries in release mode do seem to work in this way and can resolve the bundle fine*. Using an explicit bundle identifier let bundle = Bundle(identifier: "***.***.InfoCore") Using an explicit bundle identifier returns nil even though we can see the framework on disk. Using a path Using a path to access the framework also doesn't work. if let bundlePath = Bundle.main.path(forResource: "InfoCore", ofType: "framework") { let bundle = Bundle(path: bundlePath) // Now you can access resources in the framework bundle } else { // Framework bundle not found } All of the above is the same behaviour for release and debug builds. I have tried this on Xcode 15.2 and 15.3 *Mergeable libraries do seem to have issues in debug mode. See this forum post. https://forums.developer.apple.com/forums/thread/749818

Because it may be quicker to ask: with a TPP, readData() gets a data size of 0 if the process has finished writing to the network. However, there seems to be no way to find out if it has finished reading from the network, other than to do a .write() and see if you get an error. (I filed a FB about this, for whatever that's worth.) Since the API is flow-based, not socket, it's not possible to tell if the app has set its own timeout. Or exited. So one question I have is: if I do flow.write(Data(count:0)) -- is that a possible way to determine if it's still around? Or will it be interpreted as read(2) returning 0? (Putting this in for testing is difficult, but not impossible -- as I said, this might be the quickest way to find out.)

Hello, We have an iOS application (navigation/mobility app) that we need to have it stay connected to TCP server even app is in background. We tried disabling screen lock. We tried having location permission as "always". But it is not consistent. Usually, after 15 minutes, TCP connection is disconnected. We are unable to run code on app's side if it is in the background. Our other workaround option is similar to WhatsApp or what every other companies / our rivals in the market do. Have a VOIP feature, use voip notification to wake up the app. But we really don't want to do that sort of thing. Any feedback and any ideas are welcomed. Thanks.

Cannot assign a device for operation encoder/down1/downs_0/conv1/weight/Initializer/random_uniform/RandomUniform: Could not satisfy explicit device specification '' because the node {{colocation_node encoder/down1/downs_0/conv1/weight/Initializer/random_uniform/RandomUniform}} was colocated with a group of nodes that required incompatible device '/device:GPU:0'. All available devices [/job:localhost/replica:0/task:0/device:CPU:0, /job:localhost/replica:0/task:0/device:GPU:0]. Colocation Debug Info: Colocation group had the following types and supported devices: Root Member(assigned_device_name_index_=-1 requested_device_name_='/device:GPU:0' assigned_device_name_='' resource_device_name_='/device:GPU:0' supported_device_types_=[CPU] possible_devices_=[] Identity: GPU CPU Mul: GPU CPU AddV2: GPU CPU Sub: GPU CPU RandomUniform: GPU CPU Assign: CPU VariableV2: GPU CPU Const: GPU CPU

React-native 0.73.6, Xcode 14.2, CocoaAsyncSocket 7.6.5 `ld: warning: directory not found for option '-L<Multiple' ld: warning: directory not found for option '-F/Users/mr9q2/Library/Developer/Xcode/DerivedData/eduhookuser-fmwtqgvpalkgsmeiayqpwllwrscp/Build/Intermediates.noindex/ArchiveIntermediates/eduhookuser/BuildProductsPath/Release-iphoneos/XCFrameworkIntermediates/hermes-engine/Pre-built' ld: library not found for -lCocoaAsyncSocket clang: error: linker command failed with exit code 1 (use -v to see invocation)

Hello everyone, I looked at various methods how to Unit/UITest SwiftData but I couldn't find something simple. Is it even possible to test SwiftData? Does someone found a solution for that?